PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004853m
Common NameEUTSA_v10004826mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 26262.1 Da    PI: 9.0248
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004853mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF901.3e-281058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     +ienk++rqvtfskRr+g+ KKA+E+SvLCda+va+i+fs++gkl+eys
  Thhalv10004853m 10 QIENKIRRQVTFSKRRTGLVKKAQEISVLCDADVALIVFSPKGKLFEYS 58
                     69**********************************************8 PP

2K-box75.31.6e-25891641590
            K-box  15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                       ++++e +kL + i+ +qr++Rhl+Ge+++sLs++eL+ Le qL++slk+ Rs+Kn+l++e+i +lqkk ++ ++ 
  Thhalv10004853m  89 GECSTECSKLLRMIDVMQRSLRHLKGEEVDSLSIRELHALEMQLDTSLKRTRSRKNQLMVESIAQLQKKIDQREDS 164
                      57899****************************************************************8776554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.067161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.5E-31280IPR002100Transcription factor, MADS-box
CDDcd002655.89E-38279No hitNo description
PRINTSPR004041.3E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.6E-251157IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.3E-2187163IPR002487Transcription factor, K-box
PROSITE profilePS5129712.98588182IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRGRVQLRQ IENKIRRQVT FSKRRTGLVK KAQEISVLCD ADVALIVFSP KGKLFEYSAG  60
SSMERILDRY ERCSYAGQDI PTPSLDSQGE CSTECSKLLR MIDVMQRSLR HLKGEEVDSL  120
SIRELHALEM QLDTSLKRTR SRKNQLMVES IAQLQKKIDQ REDSEPQNLS QGLASLAIPP  180
CEPPHPLPRP TSPPPPLSLG GTSHRNEVGD LDAGTLIRPT NTTLPHWMPR LTGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-18170169Myocyte-specific enhancer factor 2B
1tqe_R2e-18170169Myocyte-specific enhancer factor 2B
1tqe_Q2e-18170169Myocyte-specific enhancer factor 2B
1tqe_P2e-18170169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412380.0AY141238.1 Arabidopsis thaliana MADS-box protein AGL79 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395257.11e-172hypothetical protein EUTSA_v10004826mg
SwissprotQ9SBK92e-63CAL_BRARP; Transcription factor CAULIFLOWER
TrEMBLV4KYN61e-172V4KYN6_EUTSA; Uncharacterized protein
STRINGBra036201.1-P1e-133(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30260.11e-117AGAMOUS-like 79